PDB entry 1xc8

View 1xc8 on RCSB PDB site
Description: crystal structure complex between the wild-type lactococcus lactis fpg (mutm) and a fapy-dg containing DNA
Class: hydrolase/DNA
Keywords: protein-DNA complex; glycosylase; fapy, hydrolase-DNA complex
Deposited on 2004-09-01, released 2005-09-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.178
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: formamidopyrimidine-DNA glycosylase
    Species: Lactococcus lactis [TaxId:1359]
    Gene: mutm, FPG
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1xc8a1, d1xc8a2, d1xc8a3
  • Chain 'B':
    Compound: 5'-d(*cp*tp*cp*tp*tp*tp*(fox)p*tp*tp*tp*cp*tp*cp*g)-3'
  • Chain 'C':
    Compound: 5'-d(*gp*cp*gp*ap*gp*ap*ap*ap*cp*ap*ap*ap*gp*a)-3'
  • Heterogens: ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1xc8A (A:)
pelpevetvrrelekrivgqkiisieatyprmvltgfeqlkkeltgktiqgisrrgkyli
feigddfrlishlrmegkyrlatldaprekhdhltmkfadgqliyadvrkfgtwelistd
qvlpyflkkkigpeptyedfdeklfreklrkstkkikpylleqtlvaglgniyvdevlwl
akihpeketnqliessihllhdsiieilqkaiklggssirtysalgstgkmqnelqvygk
tgekcsrcgaeiqkikvagrgthfcpvcqqk

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.