PDB entry 1xc6

View 1xc6 on RCSB PDB site
Description: Native Structure Of Beta-Galactosidase from Penicillium sp. in complex with Galactose
Class: hydrolase
Keywords: Tim Barrel Domain, Glycoside Hydrolase, Family GH35, Glycoprotein, Penicillium, Quick Cryo Soaking, HYDROLASE
Deposited on 2004-09-01, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-galactosidase
    Species: Penicillium sp. [TaxId:5081]
    Database cross-references and differences (RAF-indexed):
    • GB CAF32457 (0-970)
    Domains in SCOPe 2.07: d1xc6a1, d1xc6a2, d1xc6a3, d1xc6a4, d1xc6a5
  • Heterogens: NAG, BMA, MAN, GAL, NA, PO4, IOD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc6A (A:)
    llqkyvtwdehsifvngerlmifsgevhpyrlpvaslyidifekvkalgfncvsfyvdwa
    llegnpghysaegifdlqpffdaakeagiyllarpgpyinaevsgggfpgwlqrvdgilr
    tsdeaylkatdnyasniaatiakaqitnggpiilyqpeneysgaccgyngfpdgsymqyi
    edhardagivvpfisndawaaghnapgtgagavdiyghdsyplgfdcanpstwpsgnlpt
    yfhtsheqqspstpyslvefqggafdpwggvgfakcaallnhefervfykndfsfgvafl
    nlymifggtnwgnlghpggytsydygsaisesrnitrekyselkllgnfakvspgylvan
    pgdlststytntadltvtpllgsnssassffvirhsdyssqasveykltvptsagnltip
    qlggsltlsgrdskihvtdydvagtnilystaevftwkkfnnekvlvlyggpgehhefav
    sgassssvvegsssgisskkvgkalvvawdvstarrivqvgslkvflldrnsaynywvpq
    vptkgtapgysnqettassiivkagylvrsayldgndlhiqadfnattpievvgapsgak
    nlvingkktqtkvdkngiwsasvaytapkvqlpslkslkwksvdtlpeakntyddsawts
    adhaytnnsahslqtptslfasdygyhtgallfrghftangkektffvqtkggtayghsi
    winetyvgswagtsindnnnatytlptlqsgknyvitvvidnmgldedwtigsedmknpr
    giiqyslsgqeasaiswkltgnlggenyrdtvrgplnegglyaerqgfhqpqpptqkwds
    sspftgltkpgirfystsfdldlpsgydiplyfnfgnststpaayrvqlyvngyqygkyv
    nnigpqtsfpvpegilnyhgtnwlalslwaqedngakldsfelinttpvltslgevksvn
    qpkyqarkgay