PDB entry 1xc4

View 1xc4 on RCSB PDB site
Description: Crystal structure of wild-type tryptophan synthase alpha-subunits from Escherichia coli
Class: lyase
Keywords: tryptophan synthase, a-subunits, E.coli, wild-type, LYASE
Deposited on 2004-09-01, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.244
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tryptophan synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A877 (0-267)
      • conflict (89)
      • conflict (116)
    Domains in SCOPe 2.07: d1xc4a_
  • Chain 'B':
    Compound: tryptophan synthase alpha chain
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A877 (0-267)
      • conflict (89)
      • conflict (116)
    Domains in SCOPe 2.07: d1xc4b_
  • Heterogens: SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xc4A (A:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdplad
    gptiqnatlrafaagvtpaqcfemlalirekhptipigllmyanlvfnkgidefyarcek
    vgvdsvlvadvpveesapfrqaalrhnvapificppnadddllrqiasygrgytyllsra
    gvtgaenraalplnhlvaklkeynaapplqgfgisapdqvkaaidagaagaisgsaivki
    ieqhinepekmlaalkvfvqpmkaatrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xc4A (A:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfvtpaqc
    femlalirekhptipigllmyanlvfnkgidefyarcekvgvdsvlvadvpveesapfrq
    aalrhnvapificppnadddllrqiasygrgytyllsragaalplnhlvaklkeynaapp
    lqgfgisapdqvkaaidagaagaisgsaivkiieqhinepekmlaalkvfvqpmkaatrs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xc4B (B:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfsdplad
    gptiqnatlrafaagvtpaqcfemlalirekhptipigllmyanlvfnkgidefyarcek
    vgvdsvlvadvpveesapfrqaalrhnvapificppnadddllrqiasygrgytyllsra
    gvtgaenraalplnhlvaklkeynaapplqgfgisapdqvkaaidagaagaisgsaivki
    ieqhinepekmlaalkvfvqpmkaatrs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xc4B (B:)
    meryeslfaqlkerkegafvpfvtlgdpgieqslkiidtlieagadalelgipfvtpaqc
    femlalirekhptipigllmyanlvfnkgidefyarcekvgvdsvlvadvpveesapfrq
    aalrhnvapificppnadddllrqiasygrgytyllsragaalplnhlvaklkeynaapp
    lqgfgisapdqvkaaidagaagaisgsaivkiieqhinepekmlaalkvfvqpmkaatrs