PDB entry 1xc3

View 1xc3 on RCSB PDB site
Description: Structure of a Putative Fructokinase from Bacillus subtilis
Class: transferase
Keywords: reductively methylated, fructokinase, Zn-coordiation, structural genomics, protein structure initiative, MCSG, PSI, Midwest Center for Structural Genomics, TRANSFERASE
Deposited on 2004-08-31, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative fructokinase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: ydhR
    Database cross-references and differences (RAF-indexed):
    • Uniprot O05510 (3-End)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1xc3a1, d1xc3a2, d1xc3a3
  • Heterogens: PT, ZN, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xc3A (A:)
    snamlggieaggtkfvcavgredgtiidriefptkmpdetiekviqyfsqfslqaigigs
    fgpvdndktsqtygtitatpkagwrhypflqtvknemkipvgfstdvnaaalgeflfgea
    kgldsclyitigtgigagaivegrllqglshpemghiyirrhpddvyqgkcpyhgdcfeg
    lasgpaiearwgkkaadlsdiaqvwelegyyiaqalaqyililapkkiilgggvmqqkqv
    fsyiyqyvpkimnsyldfselsddisdyivpprlgsnagiigtlvlahqalqaeaasgev
    rs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xc3A (A:)
    amlggieaggtkfvcavgredgtiidriefptkmpdetiekviqyfsqfslqaigigsfg
    pvdndktsqtygtitatpkagwrhypflqtvknemkipvgfstdvnaaalgeflfgeakg
    ldsclyitigtgigagaivegrllqglshpemghiyirrhpddvyqgkcpyhgdcfegla
    sgpaiearwgkkaadlsdiaqvwelegyyiaqalaqyililapkkiilgggvmqqkqvfs
    yiyqyvpkimnsyldfselsddisdyivpprlgsnagiigtlvlahqalqaeaas