PDB entry 1xc2

View 1xc2 on RCSB PDB site
Description: Crystal Structure of a Pyrroline-5-Carboxylate Reductase from Neisseria meningitides MC58
Class: oxidoreductase
Keywords: Pyrroline-5-Carboxylate Reductase, MCSG, structural genomics, protein structure initiative, PSI, Midwest Center for Structural Genomics
Deposited on 2004-08-31, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-02-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: pyrroline-5-carboxylate reductase
    Species: Neisseria meningitidis MC58
    Database cross-references and differences (RAF-indexed):
    • GB NP_273120 (0-262)
      • modified residue (0)
      • modified residue (10)
      • modified residue (69)
      • modified residue (109)
      • modified residue (123)
      • modified residue (141)
      • modified residue (156)
      • modified residue (188)
      • modified residue (257)
    Domains in SCOPe 2.07: d1xc2a3, d1xc2a4
  • Heterogens: PRO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc2A (A:)
    mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddv
    lilavkpqdmeaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglg
    vsgmyaeaevsetdrriadrimksvgltvwlddeekmhgitgisgsgpayvfylldalqn
    aairqgfdmaearalslatfkgavalaeqtgedfeklqknvtskggttheaveafrrhrv
    aeaisegvcacvrrsqemerqyq