PDB entry 1xc2

View 1xc2 on RCSB PDB site
Description: Crystal Structure of a Pyrroline-5-Carboxylate Reductase from Neisseria meningitides MC58
Class: oxidoreductase
Keywords: Pyrroline-5-Carboxylate Reductase, MCSG, structural genomics, protein structure initiative, PSI, Midwest Center for Structural Genomics
Deposited on 2004-08-31, released 2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2005-02-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.195
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: pyrroline-5-carboxylate reductase
  Species: Neisseria meningitidis MC58
  Database cross-references and differences (RAF-indexed):
  • GB NP_273120 (0-262)
    • modified residue (0)
    • modified residue (10)
    • modified residue (69)
    • modified residue (109)
    • modified residue (123)
    • modified residue (141)
    • modified residue (156)
    • modified residue (188)
    • modified residue (257)
  Domains in SCOPe 2.08: d1xc2a3, d1xc2a4
• Heterogens: PRO, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xc2A (A:)
  mnvyflgggnmaaavagglvkqggyriyianrgaekrerlekelgvetsatlpelhsddv
  lilavkpqdmeaacknirtngalvlsvaaglsvgtlsrylggtrrivrvmpntpgkiglg
  vsgmyaeaevsetdrriadrimksvgltvwlddeekmhgitgisgsgpayvfylldalqn
  aairqgfdmaearalslatfkgavalaeqtgedfeklqknvtskggttheaveafrrhrv
  aeaisegvcacvrrsqemerqyq