PDB entry 1xc1

View 1xc1 on RCSB PDB site
Description: Oxo Zirconium(IV) Cluster in the Ferric Binding Protein (FBP)
Class: metal transport
Keywords: periplasmic ferric binding protein, zirconium, metal-oxo cluster, metal transport
Deposited on 2004-08-31, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.51 Å
R-factor: 0.191
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1a_
  • Chain 'B':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1b_
  • Chain 'C':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1c_
  • Chain 'D':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1d_
  • Chain 'E':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1e_
  • Chain 'F':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1f_
  • Chain 'G':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1g_
  • Chain 'H':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1h_
  • Chain 'I':
    Compound: periplasmic iron-binding protein
    Species: NEISSERIA GONORRHOEAE [TaxId:485]
    Gene: fbpA
    Database cross-references and differences (RAF-indexed):
    • GB AAB63559 (0-308)
    Domains in SCOPe 2.07: d1xc1i_
  • Heterogens: ZRC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1A (A:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1B (B:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1C (C:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1D (D:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1E (E:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1F (F:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1G (G:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1H (H:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc1I (I:)
    ditvyngqhkeaaqavadaftratgikvklnsakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk