PDB entry 1xc0

View 1xc0 on RCSB PDB site
Description: Twenty Lowest Energy Structures of Pa4 by Solution NMR
Class: signaling protein
Keywords: Bend-helix-bend-helix motif, SIGNALING PROTEIN
Deposited on 2004-08-31, released 2004-09-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pardaxin P-4
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xc0a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xc0A (A:)
    gffalipkiissplfktllsavgsalsssggqe