PDB entry 1xbw

View 1xbw on RCSB PDB site
Description: 1.9A Crystal Structure of the protein isdG from Staphylococcus aureus aureus, Structural genomics, MCSG
Class: structural genomics, unknown function
Keywords: Structural genomics, protein structure initiative, MCSG, staphylococcus aureus, protein isdG, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-08-31, released 2004-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.23
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein isdG
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: GI:1003130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NX62 (2-108)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1xbwa1, d1xbwa2
  • Chain 'B':
    Compound: hypothetical protein isdG
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: GI:1003130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NX62 (2-108)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d1xbwb1, d1xbwb2
  • Chain 'C':
    Compound: hypothetical protein isdG
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: GI:1003130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NX62 (2-108)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d1xbwc1, d1xbwc2
  • Chain 'D':
    Compound: hypothetical protein isdG
    Species: Staphylococcus aureus [TaxId:196620]
    Gene: GI:1003130
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NX62 (2-108)
      • cloning artifact (1)
    Domains in SCOPe 2.07: d1xbwd1, d1xbwd2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xbwA (A:)
    etmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvw
    kskqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbwA (A:)
    etmkfmaenrltltkgtakdiierfytrhgietlgfdgmfvtqtleqedfdevkiltvwk
    skqaftdwlksdvfkaahkhvpiinnkvitydigysymk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xbwB (B:)
    etmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvw
    kskqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbwB (B:)
    tmkfmaenrltltkgtakdiierfytgietlegfdgmfvtqtleqedfdevkiltvwksk
    qaftdwlkvrsknedesspiinnkvitydigysymk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xbwC (C:)
    etmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvw
    kskqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbwC (C:)
    tmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwk
    skqaftdwlksspiinnkvitydigysymk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xbwD (D:)
    etmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvw
    kskqaftdwlksdvfkaahkhvrsknedesspiinnkvitydigysymk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbwD (D:)
    tmkfmaenrltltkgtakdiierfytrhgietlegfdgmfvtqtleqedfdevkiltvwk
    skqaftdwlksdvfkaahkspiinnkvitydigysymk