PDB entry 1xbs

View 1xbs on RCSB PDB site
Description: Crystal structure of human dim2: a dim1-like protein
Class: transcription, cell cycle
Keywords: spliceosomal protein, cell cycle, thioredoxin, snrnp, transcription
Deposited on 2004-08-31, released 2005-08-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dim1-like protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB AAS68520 (0-End)
    Domains in SCOPe 2.08: d1xbsa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xbsA (A:)
    msfllpkltskkevdqaikstaekvlvlrfgrdedpvclqlddilsktssdlskmaaiyl
    vdvdqtavytqyfdisyipstvfffngqhmkvdygspdhtkfvgsfktkqdfidlieviy
    rgamrgklivqspidpknipkydllyqdi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbsA (A:)
    msfllpkltskkevdqaikstaekvlvlrfgrdedpvclqlddilsktssdlskmaaiyl
    vdvdqtavytqyfdisyipstvfffngqhmkvdygspdhtkfvgsfktkqdfidlieviy
    rgamrgklivqspidpk