PDB entry 1xbr

View 1xbr on RCSB PDB site
Description: t domain from xenopus laevis bound to DNA
Class: transcription/DNA
Keywords: complex (transcription factor/DNA), transcription factor, DNA-binding protein, transcription/DNA complex
Deposited on 1997-07-16, released 1998-01-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (t protein)
    Species: Xenopus laevis [TaxId:8355]
    Gene: XBRA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xbra_
  • Chain 'B':
    Compound: protein (t protein)
    Species: Xenopus laevis [TaxId:8355]
    Gene: XBRA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xbrb_
  • Chain 'C':
    Compound: DNA (5'-d(*ap*ap*tp*tp*tp*cp*ap*cp*ap*cp*cp*tp*ap*gp*gp*tp*g p*tp*gp*ap*ap*ap* tp*t)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*ap*ap*tp*tp*tp*cp*ap*cp*ap*cp*cp*tp*ap*gp*gp*tp*g p*tp*gp*ap*ap*ap* tp*t)-3')
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xbrA (A:)
    elkvsleerdlwtrfkeltnemivtkngrrmfpvlkvsmsgldpnamytvlldfvaadnh
    rwkyvngewvpggkpepqapscvyihpdspnfgahwmkdpvsfskvkltnkmngggqiml
    nslhkyeprihivrvggtqrmitshsfpetqfiavtayqneeitalkikhnpfakaflda
    kern
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xbrB (B:)
    elkvsleerdlwtrfkeltnemivtkngrrmfpvlkvsmsgldpnamytvlldfvaadnh
    rwkyvngewvpggkpepqapscvyihpdspnfgahwmkdpvsfskvkltnkmngggqiml
    nslhkyeprihivrvggtqrmitshsfpetqfiavtayqneeitalkikhnpfakaflda
    kern
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbrB (B:)
    elkvsleerdlwtrfkeltnemivtkngrrmfpvlkvsmsgldpnamytvlldfvaadnh
    rwkyvngewvpggkpepqapscvyihpdspnfgahwmkdpvsfskvkltnkmngggqiml
    nslhkyeprihivrvggtqrmitshsfpetqfiavtayqneeitalkikhnpfakaflda
    ker
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.