PDB entry 1xbo
View 1xbo on RCSB PDB site
Description: PTP1B complexed with Isoxazole Carboxylic Acid
Class: hydrolase
Keywords: Protein Tyrosine Phosphatase 1B, PTP1B, Isoxazole Carboxylic Acid, HYDROLASE
Deposited on
2004-08-31, released
2004-10-19
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-11, with a file datestamp of
2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: protein-tyrosine phosphatase, non-receptor type 1
Species: Homo sapiens [TaxId:9606]
Gene: PTPN1, PTP1B
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1xboa_ - Heterogens: IX1, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>1xboA (A:)
memekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklh
qedndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslk
caqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwp
dfgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkd
pssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle
pppehipppprppkrilephn
Sequence, based on observed residues (ATOM records): (download)
>1xboA (A:)
emekefeqidksgswaaiyqdirheasdfpcrvaklpknknrnryrdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntcghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshedle