PDB entry 1xbl

View 1xbl on RCSB PDB site
Description: nmr structure of the j-domain (residues 2-76) in the escherichia coli n-terminal fragment (residues 2-108) of the molecular chaperone dnaj, 20 structures
Class: chaperone
Keywords: chaperone, DNA replication, heat shock, repeat
Deposited on 1996-10-07, released 1997-01-11
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dnaj
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1xbla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xblA (A:)
    akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
    kraaydqyghaafeqggmggggfgggadfsdifgdvfgdifgggrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xblA (A:)
    akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
    kraaydqyghaafeq