PDB entry 1xbl

View 1xbl on RCSB PDB site
Description: nmr structure of the j-domain (residues 2-76) in the escherichia coli n-terminal fragment (residues 2-108) of the molecular chaperone dnaj, 20 structures
Deposited on 1996-10-07, released 1997-01-11
The last revision prior to the SCOP 1.67 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1xbl__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1xbl_ (-)
    akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
    kraaydqyghaafeqggmggggfgggadfsdifgdvfgdifgggrgr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbl_ (-)
    akqdyyeilgvsktaeereirkaykrlamkyhpdrnqgdkeaeakfkeikeayevltdsq
    kraaydqyghaafeq