PDB entry 1xbf

View 1xbf on RCSB PDB site
Description: x-ray structure northeast structural genomics consortium target car10 from c. acetobutylicum
Class: structural genomics, unknown function
Keywords: CAR10, Q97KL0, STRUCTURAL GENOMICS, PROTEIN STRUCTURE INITIATIVE, NESG, PSI, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2004-08-30, released 2004-09-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Clostridium acetobutylicum Q97KL0
    Species: Clostridium acetobutylicum [TaxId:1488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97KL0 (Start-131)
      • modified residue (36)
      • modified residue (92)
      • cloning artifact (132-133)
    Domains in SCOPe 2.07: d1xbfa1, d1xbfa2
  • Chain 'B':
    Compound: Clostridium acetobutylicum Q97KL0
    Species: Clostridium acetobutylicum [TaxId:1488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97KL0 (Start-131)
      • modified residue (36)
      • modified residue (92)
      • cloning artifact (132)
    Domains in SCOPe 2.07: d1xbfb1, d1xbfb2
  • Chain 'C':
    Compound: Clostridium acetobutylicum Q97KL0
    Species: Clostridium acetobutylicum [TaxId:1488]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97KL0 (Start-131)
      • modified residue (36)
      • modified residue (92)
      • cloning artifact (132)
    Domains in SCOPe 2.07: d1xbfc1, d1xbfc2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xbfA (A:)
    mkgvieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvt
    rdilvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefd
    gprdrkvfvkiilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbfA (A:)
    vieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvtrdi
    lvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefdgpr
    drkvfvkiile
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xbfB (B:)
    mkgvieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvt
    rdilvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefd
    gprdrkvfvkiilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbfB (B:)
    vieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvtrdi
    lvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefdgpr
    drkvfvkiil
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xbfC (C:)
    mkgvieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvt
    rdilvnldkvfpkvgdykhvegnshahikaslmgssqqiiiengklklgtwqgiyftefd
    gprdrkvfvkiilehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbfC (C:)
    gvieyslktsnddqfiditnlvkkavdesgvsdgmavvfcphttagitinenadpdvtrd
    ilvnldkvfpnshahikaslmgssqqiiiengklklgtwqgiyftefdgprdrkvfvkii
    l