PDB entry 1xbd

View 1xbd on RCSB PDB site
Description: internal xylan binding domain from cellulomonas fimi xylanase d, nmr, 5 structures
Class: hydrolase
Keywords: hydrolase, xylan binding domain, xylanase, beta-sheet
Deposited on 1998-10-16, released 1999-07-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: xylanase d
    Species: CELLULOMONAS FIMI [TaxId:1708]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xbda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xbdA (A:)
    tgcsvtatraeewsdrfnvtysvsgssawtvnlalngsqtiqaswnanvtgsgstrtvtp
    ngsgntfgvtvmkngssttpaatcags