PDB entry 1xbc

View 1xbc on RCSB PDB site
Description: crystal structure of the syk tyrosine kinase domain with staurosporin
Deposited on 2004-08-30, released 2004-11-02
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-02, with a file datestamp of 2004-11-02.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.246
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xbca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xbcA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbcA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilpalkdellaeanvmqqld
    npyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkylees
    nfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyyk
    fssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlc
    wtydvenrpgfaavelrlrnyyydvvne