PDB entry 1xba

View 1xba on RCSB PDB site
Description: Crystal structure of apo syk tyrosine kinase domain
Class: Transferase
Keywords: spleen typrosine kinase, active conformation, structural genomics, Structural GenomiX
Deposited on 2004-08-30, released 2004-11-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-03-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.231
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase SYK
    Species: HOMO SAPIENS
    Gene: SYK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P43405 (Start-282)
      • cloning artifact (283)
    Domains in SCOP 1.73: d1xbaa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xbaA (A:)
    maleeirpkevyldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpa
    lkdellaeanvmqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdknii
    elvhqvsmgmkyleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthg
    kwpvkwyapecinyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermg
    cpagcpremydlmnlcwtydvenrpgfaavelrlrnyyydvvneghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xbaA (A:)
    vyldrklltledkelgsgnfgtvkkgyyqmvvktvavkilpalkdellaeanvmqqldnp
    yivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmkyleesnf
    vhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapecinyykfs
    sksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremydlmnlcwt
    ydvenrpgfaavelrlrnyyydvvne