PDB entry 1xb9

View 1xb9 on RCSB PDB site
Description: The structure and function of Xenopus NO38-core, a histone chaperone in the nucleolus
Class: chaperone
Keywords: NO38, drosophila Nucleoplasmin-like protein (dNLP), Nucleoplasmin (Np), histone binding, X-ray Crystallography, CHAPERONE
Deposited on 2004-08-30, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9a1, d1xb9a2
  • Chain 'B':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9b1, d1xb9b2
  • Chain 'C':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9c1, d1xb9c2
  • Chain 'D':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9d1, d1xb9d2
  • Chain 'E':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9e1, d1xb9e2
  • Chain 'F':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9f1, d1xb9f2
  • Chain 'G':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9g1, d1xb9g2
  • Chain 'H':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9h1, d1xb9h2
  • Chain 'I':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9i1, d1xb9i2
  • Chain 'J':
    Compound: Nucleophosmin
    Species: Xenopus laevis [TaxId:8355]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07222 (5-End)
      • cloning artifact (4)
    Domains in SCOPe 2.07: d1xb9j1, d1xb9j2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb9A (A:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9A (A:)
    sqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkti
    kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xb9B (B:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9B (B:)
    sqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkti
    kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xb9C (C:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9C (C:)
    sqnflfgcelkadkkeysfkveddehqlslrtvslgasakdelhvveaeginyegktiki
    alaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlva
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xb9D (D:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9D (D:)
    sqnflfgcelkadkkeysfveddenehqlslrtvslgasakdelhvveaeginyegktik
    ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlv
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xb9E (E:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9E (E:)
    sqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkti
    kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlva
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xb9F (F:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9F (F:)
    sqnflfgcelkadkkeysfkvedenehqlslrtvslgasakdelhvveaeginyegktik
    ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlva
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1xb9G (G:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9G (G:)
    sqnflfgcelkadkkeysfkvdenehqlslrtvslgasakdelhvveaeginyegktiki
    alaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1xb9H (H:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9H (H:)
    sqnflfgcelkadkkeysfkveddnehqlslrtvslgasakdelhvveaeginyegktik
    ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvale
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1xb9I (I:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9I (I:)
    sqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginyegkti
    kialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1xb9J (J:)
    vprgsqnflfgcelkadkkeysfkveddenehqlslrtvslgasakdelhvveaeginye
    gktikialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlvaledl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb9J (J:)
    sqnflfgcelkadkkeysfkvddenehqlslrtvslgasakdelhvveaeginyegktik
    ialaslkpsvqptvslggfeitppvilrlksgsgpvyvsgqhlval