PDB entry 1xb7

View 1xb7 on RCSB PDB site
Description: X-ray structure of ERRalpha LBD in complex with a PGC-1alpha peptide at 2.5A resolution
Class: transcription
Keywords: nuclear hormone receptor, ligand binding domain, three-layered alpha-helical sandwich, coactivator peptide, amphipathic alpha-helix, TRANSCRIPTION
Deposited on 2004-08-30, released 2004-09-14
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Steroid hormone receptor ERR1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11474 (17-End)
      • expression tag (9-16)
    Domains in SCOPe 2.05: d1xb7a_
  • Chain 'P':
    Compound: Peroxisome proliferator activated receptor gamma coactivator 1 alpha
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: IOD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb7A (A:)
    gsshhhhhhlevlfqgpvnalvshllvvepeklyampdpagpdghlpavatlcdlfdrei
    vvtiswaksipgfsslslsdqmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeeg
    araaglgelgaallqlvrrlqalrlereeyvllkalalansdsvhiedaeaveqlrealh
    ealleyeagragpgggaerrragrllltlpllrqtagkvlahfygvklegkvpmhklfle
    mleammd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb7A (A:)
    levlfqgpvnalvshllvvepeklyamavatlcdlfdreivvtiswaksipgfsslslsd
    qmsvlqsvwmevlvlgvaqrslplqdelafaedlvldeegaraaglgelgaallqlvrrl
    qalrlereeyvllkalalansdsvhiedaeaveqlrealhealleyeagrrragrllltl
    pllrqtagkvlahfygvklegkvpmhklflemlea
    

  • Chain 'P':
    No sequence available.