PDB entry 1xb3

View 1xb3 on RCSB PDB site
Description: The D62C/K74C double mutant of Pseudomonas Aeruginosa Azurin
Class: electron transport
Keywords: Azurin; Electron Transport; Thermostability; Mutant, ELECTRON TRANSPORT
Deposited on 2004-08-27, released 2004-10-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: N/A
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (61)
      • engineered (73)
      • engineered (103)
    Domains in SCOPe 2.07: d1xb3a_
  • Chain 'B':
    Compound: Azurin
    Species: Pseudomonas aeruginosa [TaxId:287]
    Gene: AZU
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00282 (0-127)
      • engineered (61)
      • engineered (73)
      • engineered (103)
    Domains in SCOPe 2.07: d1xb3b_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xb3A (A:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tcgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkggeqymffctfpghsal
    mkgtltlk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xb3B (B:)
    aecsvdiqgndqmqfntnaitvdksckqftvnlshpgnlpknvmghnwvlstaadmqgvv
    tcgmasgldkdylcpddsrviahtkligsgekdsvtfdvsklkggeqymffctfpghsal
    mkgtltlk