PDB entry 1xb1

View 1xb1 on RCSB PDB site
Description: The Structure of the BIR domain of IAP-like protein 2
Class: apoptosis
Keywords: Apoptosis, IAP, caspase inhibition, SMAC, Diabolo
Deposited on 2004-08-27, released 2004-11-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (6-12)
    Domains in SCOPe 2.08: d1xb1a_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-107)
      • see remark 999 (6-12)
    Domains in SCOPe 2.08: d1xb1b_
  • Chain 'C':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (6-12)
    Domains in SCOPe 2.08: d1xb1c_
  • Chain 'D':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (6-12)
    Domains in SCOPe 2.08: d1xb1d_
  • Chain 'E':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-107)
      • see remark 999 (6-12)
    Domains in SCOPe 2.08: d1xb1e_
  • Chain 'F':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (6-12)
    Domains in SCOPe 2.08: d1xb1f_
  • Chain 'G':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb1A (A:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb1A (A:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xb1B (B:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb1B (B:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xb1C (C:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb1C (C:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xb1D (D:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb1D (D:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xb1E (E:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb1E (E:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xb1F (F:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb1F (F:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnih
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.