PDB entry 1xb0

View 1xb0 on RCSB PDB site
Description: Structure of the BIR domain of IAP-like protein 2
Class: apoptosis
Keywords: smac, diablo, apoptosis, caspase inhibition, xiap
Deposited on 2004-08-27, released 2004-11-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.223
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (5-12)
    Domains in SCOPe 2.07: d1xb0a_
  • Chain 'B':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-107)
      • see remark 999 (7-12)
    Domains in SCOPe 2.07: d1xb0b_
  • Chain 'C':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (6-12)
    Domains in SCOPe 2.07: d1xb0c_
  • Chain 'D':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (6-12)
    Domains in SCOPe 2.07: d1xb0d_
  • Chain 'E':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-End)
      • see remark 999 (6-12)
    Domains in SCOPe 2.07: d1xb0e_
  • Chain 'F':
    Compound: Baculoviral IAP repeat-containing protein 8
    Species: Homo sapiens [TaxId:9606]
    Gene: BIRC8, ILP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q96P09 (13-107)
      • see remark 999 (5-12)
    Domains in SCOPe 2.07: d1xb0f_
  • Chain 'G':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'H':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'I':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'J':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'K':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Chain 'L':
    Compound: Diablo homolog, mitochondrial
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xb0A (A:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb0A (A:)
    tnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpk
    edpweqhakwypgckylleekgheyinnihlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xb0B (B:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb0B (B:)
    lprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpked
    pweqhakwypgckylleekgheyinnihltrslegalvqtt
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xb0C (C:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb0C (C:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihlt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xb0D (D:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb0D (D:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihlt
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1xb0E (E:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb0E (E:)
    nlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpke
    dpweqhakwypgckylleekgheyinnihltrs
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1xb0F (F:)
    gshmstnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcgggla
    nwkpkedpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xb0F (F:)
    tnlprnpsmtgyearlitfgtwmysvnkeqlaragfyaigqedkvqcfhcggglanwkpk
    edpweqhakwypgckylleekgheyinnihltrslegalvqtt
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.