PDB entry 1xax

View 1xax on RCSB PDB site
Description: NMR structure of HI0004, a putative essential gene product from Haemophilus influenzae
Class: structural genomics, unknown function
Keywords: Haemophilus influenzae, NMR, structural genomics, MMP, hydrolase, protein structure initiative, S2F, Structure 2 Function Project, unknown function
Deposited on 2004-08-26, released 2005-01-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical UPF0054 protein HI0004
    Species: Haemophilus influenzae [TaxId:727]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xaxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xaxA (A:)
    mgsvlvdlqiatenieglpteeqivqwatgavqpegnevemtvrivdeaeshelnltyrg
    kdrptnvlsfpfecpdevelpllgdlvicrqvvereaseqekplmahwahmvvhgslhll
    gydhieddeaeemesletqimqglgfddpylaek
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xaxA (A:)
    svlvdlqiatenieglpteeqivqwatgavqpegnevemtvrivdeaeshelnltyrgkd
    rptnvlsfpfecpdevelpllgdlvicrqvvereaseqekplmahwahmvvhgslhllgy
    dhieddeaeemesletqimqglgf