PDB entry 1xaw

View 1xaw on RCSB PDB site
Description: crystal structure of the cytoplasmic distal C-terminal domain of occludin
Class: cell adhesion
Keywords: coiled-coil, cell adhesion
Deposited on 2004-08-26, released 2005-09-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.261
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Occludin
    Species: Homo sapiens [TaxId:9606]
    Gene: OCLN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16625 (Start-139)
      • engineered (66)
    Domains in SCOPe 2.06: d1xawa1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xawA (A:)
    akgragrskrteqdhyetdyttggescdeleedwireyppitsdqqrqlykrnfdtglqe
    ykslqsvldeinkelsrldkelddyreeseeymaaadeynrlkqvkgsadykskknhckq
    lksklshikkmvgdydrqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xawA (A:)
    wireyppitsdqqrqlykrnfdtglqeykslqsvldeinkelsrldkelddyreeseeym
    aaadeynrlkqvkgsadykskknhckqlksklshikkmvgdydrqkt