PDB entry 1xau

View 1xau on RCSB PDB site
Description: structure of the btla ectodomain
Class: immune system
Keywords: IG DOMAIN, BETA SANDWICH, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, IMMUNE SYSTEM
Deposited on 2004-08-26, released 2004-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-09-22, with a file datestamp of 2009-09-18.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B- and T-lymphocyte attenuator
    Species: Mus musculus [TaxId:10090]
    Gene: BALB/c BTLA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xaua_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xauA (A:)
    mekatkrndeecevqlnikrnskhsawtgelfkiecpvkycvhrpnvtwckhngtiwvpl
    evgpqlytsweenrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsvtihvrersqn
    ss
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xauA (A:)
    cevqlnikrnskhsawtgelfkiecpvkycvhrpnvtwckhngtiwvplevgpqlytswe
    enrsvpvfvlhfkpihlsdngsyscstnfnsqvinshsvtihvr