PDB entry 1xas

View 1xas on RCSB PDB site
Description: crystal structure, at 2.6 angstroms resolution, of the streptomyces lividans xylanase a, a member of the f family of beta-1,4-d-glycanses
Class: xylanase a
Keywords: xylanase a
Deposited on 1994-05-31, released 1995-05-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-07.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.21
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 1,4-beta-d-xylan xylanohydrolase
    Species: Streptomyces lividans [TaxId:1916]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xasa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xasA (A:)
    aestlgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfn
    fssadrvynwavqngkqvrghtlawhsqqpgwmqslsgrplrqamidhingvmahykgki
    vqwdvvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwa
    ktqamynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiq
    gapastyanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavlda
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xasA (A:)
    lgaaaaqsgryfgtaiasgrlsdstytsiagrefnmvtaenemkidatepqrgqfnfssa
    drvynwavqngkqvrghtlawhsqqpgwmqslsgrplrqamidhingvmahykgkivqwd
    vvneafadgssgarrdsnlqrsgndwievafrtaraadpsaklcyndynvenwtwaktqa
    mynmvrdfkqrgvpidcvgfqshfnsgspynsnfrttlqnfaalgvdvaiteldiqgapa
    styanvtndclavsrclgitvwgvrdsdswrseqtpllfnndgskkaaytavlda