PDB entry 1xar

View 1xar on RCSB PDB site
Description: Crystal Structure of a fragment of DC-SIGNR (containing the carbohydrate recognition domain and two repeats of the neck).
Class: sugar binding protein
Keywords: DC-SIGNR, C-Type lectin, SUGAR BINDING PROTEIN
Deposited on 2004-08-26, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.222
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CD209 antigen-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209L, CD209L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xara_
  • Chain 'B':
    Compound: CD209 antigen-like protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CD209L, CD209L1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xarb_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xarA (A:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xarA (A:)
    yqeltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktae
    eqnflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcae
    fsgsgwndnrcdvdnywickkpaacf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xarB (B:)
    gelpeksklqeiyqeltqlkaavgelpdqskqqqiyqeltdlktaferlcrhcpkdwtff
    qgncyfmsnsqrnwhdsvtacqevraqlvviktaeeqnflqlqtsrsnrfswmglsdlnq
    egtwqwvdgsplspsfqrywnsgepnnsgnedcaefsgsgwndnrcdvdnywickkpaac
    frde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xarB (B:)
    eltdlktaferlcrhcpkdwtffqgncyfmsnsqrnwhdsvtacqevraqlvviktaeeq
    nflqlqtsrsnrfswmglsdlnqegtwqwvdgsplspsfqrywnsgepnnsgnedcaefs
    gsgwndnrcdvdnywickkpaacf