PDB entry 1xaq

View 1xaq on RCSB PDB site
Description: yeast frataxin solution structure
Class: transport protein
Keywords: Yfh1p, NMR, structure
Deposited on 2004-08-26, released 2005-05-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2006-03-21, with a file datestamp of 2007-06-01.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Frataxin homolog, mitochondrial
  Species: Saccharomyces cerevisiae
  Gene: YFH1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q07540 (1-122)
    • cloning artifact (0)
  Domains in SCOPe 2.06: d1xaqa1, d1xaqa2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1xaqA (A:)
  messtdgqvvpqevlnlplekyheeaddyldhlldsleelseahpdcipdvelshgvmtl
  eipafgtyvinkqppnkqiwlasplsgpnrfdllngewvslrngtkltdilteevekais
  ksq