PDB entry 1xap

View 1xap on RCSB PDB site
Description: structure of the ligand binding domain of the retinoic acid receptor beta
Deposited on 2004-08-26, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.213
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xapa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xapA (A:)
    mgsshhhhhhssglvprgshmesyemtaelddltekirkahqetfpslcqlgkyttnssa
    dhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililric
    trytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsaicl
    icgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakgaer
    vitlkmeipgsmppliqemlenseghe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xapA (A:)
    aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
    fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
    fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
    yirkrrphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlen