PDB entry 1xap

View 1xap on RCSB PDB site
Description: Structure of the ligand binding domain of the Retinoic Acid Receptor beta
Class: transcription
Keywords: nuclear receptor, ligand binding domain, retinoic acid receptor beta, TTNPB, TRANSCRIPTION
Deposited on 2004-08-26, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Retinoic acid receptor beta
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1xapa_
  • Heterogens: TTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xapA (A:)
    mgsshhhhhhssglvprgshmesyemtaelddltekirkahqetfpslcqlgkyttnssa
    dhrvrldlglwdkfselatkciikivefakrlpgftgltiadqitllkaacldililric
    trytpeqdtmtfsdgltlnrtqmhnagfgpltdlvftfanqllplemddtetgllsaicl
    icgdrqdleeptkvdklqepllealkiyirkrrpskphmfpkilmkitdlrsisakgaer
    vitlkmeipgsmppliqemlenseghe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xapA (A:)
    aelddltekirkahqetfpslcqlgkyttnssadhrvrldlglwdkfselatkciikive
    fakrlpgftgltiadqitllkaacldililrictrytpeqdtmtfsdgltlnrtqmhnag
    fgpltdlvftfanqllplemddtetgllsaiclicgdrqdleeptkvdklqepllealki
    yirkrrphmfpkilmkitdlrsisakgaervitlkmeipgsmppliqemlen