PDB entry 1xao

View 1xao on RCSB PDB site
Description: hsp40-ydj1 dimerization domain
Deposited on 2004-08-26, released 2005-05-03
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitochondrial protein import protein MAS5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAS5, YDJ1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Mitochondrial protein import protein MAS5
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: MAS5, YDJ1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xaoA (A:)
    sfkrdgddlvyeaeidlltaiaggefalehvsgdwlkvgivpgeviapgmrkviegkgmp
    ipkyggygnliikftikfpenhftseenlkkleeilpprivpaipkkatvdecvladfdp
    a
    

    Sequence, based on observed residues (ATOM records):
    >1xaoA (A:)
    sfkrdgddlvyeaeidlltaiaggefalehvsgdwlkvgivpgeviapgmrkviegkgmp
    ygnliikftikfpenhftseenlkkleeilpprivpaipkkatvdecvladfdpa
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xaoB (B:)
    sfkrdgddlvyeaeidlltaiaggefalehvsgdwlkvgivpgeviapgmrkviegkgmp
    ipkyggygnliikftikfpenhftseenlkkleeilpprivpaipkkatvdecvladfdp
    a
    

    Sequence, based on observed residues (ATOM records):
    >1xaoB (B:)
    sfkrdgddlvyeaeidlltaiaggefalehvsgdwlkvgivpgeviapgmrkviegkgmp
    ygnliikftikfpenhftseenlkkleeilpprivpaipkkatvdecvladfdpa