PDB entry 1xan

View 1xan on RCSB PDB site
Description: human glutathione reductase in complex with a xanthene inhibitor
Class: glutathione reductase
Keywords: oxidoreductase, flavoenzyme, glutathione reducatase, glutathione reductase
Deposited on 1996-01-26, released 1996-07-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.158
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione reductase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1xana1, d1xana2, d1xana3
  • Heterogens: FAD, HXP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xanA (A:)
    vasydylvigggsgglasarraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
    fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
    ptievsgkkytaphiliatggmpstphesqipgaslgitsdgffqleelpgrsvivgagy
    iavemagilsalgsktslmirhdkvlrsfdsmistncteelenagvevlkfsqvkevkkt
    lsglevsmvtavpgrlpvmtmipdvdcllwaigrvpntkdlslnklgiqtddkghiivde
    fqntnvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskldynniptvvfshppi
    gtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqg
    lgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr