PDB entry 1xak

View 1xak on RCSB PDB site
Description: structure of the sars-coronavirus orf7a accessory protein
Class: Viral protein
Keywords: I-SET IG DOMAIN, BETA SANDWICH, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2004-08-26, released 2004-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.223
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: sars orf7a accessory protein
  Species: Human SARS coronavirus
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59635
    • conflict (16)
  Domains in SCOP 1.75: d1xaka_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1xakA (A:)
  scelyhyqecvrgttvilkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrh
  tyqlrarsvspklfirqeevqqe
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1xakA (A:)
  celyhyqecvrgttvilkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrht
  yqlrarsv