PDB entry 1xah

View 1xah on RCSB PDB site
Description: crystal structure of staphlyococcus aureus 3-dehydroquinate synthase (dhqs) in complex with zn2+ and nad+
Deposited on 2004-08-25, released 2005-03-01
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.21
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-dehydroquinate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aroB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GGU4 (0-End)
      • see remark 999 (21-22)
      • see remark 999 (24)
      • see remark 999 (27-28)
      • see remark 999 (35)
      • see remark 999 (40)
      • see remark 999 (47)
      • see remark 999 (108)
      • see remark 999 (169)
      • see remark 999 (225)
      • see remark 999 (281)
      • see remark 999 (325)
  • Chain 'B':
    Compound: 3-dehydroquinate synthase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: aroB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6GGU4 (0-End)
      • see remark 999 (21-22)
      • see remark 999 (24)
      • see remark 999 (27-28)
      • see remark 999 (35)
      • see remark 999 (40)
      • see remark 999 (47)
      • see remark 999 (108)
      • see remark 999 (169)
      • see remark 999 (225)
      • see remark 999 (281)
      • see remark 999 (325)
  • Heterogens: ZN, NAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1xahA (A:)
    mklqttypsnnypiyvehgaikyigtylnqfdqsfllideyvnqyfankfddilsyenvh
    kviipagektktfeqyqetleyilshhvtrntaiiavgggatgdfagfvaatllrgvhfi
    qvpttilahdssvggkvginskqgknligafyrptaviydldflktlpfkqilsgyaevy
    khallngesatqdieqhfkdreilqslngmdkyiakgietkldivvadekeqgvrkflnl
    ghtfghaveyyhkiphghavmvgiiyqfivanalfdskhdishyiqyliqlgypldmitd
    ldfetlyqymlsdkkndkqgvqmvlmrqfgdivvqhvdqltlqhaceqlktyfk
    

    Sequence, based on observed residues (ATOM records):
    >1xahA (A:)
    mklqttypsnnypiyvehgaikyigtylnqfdqsfllideyvnqyfankfdnvhkviipa
    gektktfeqyqetleyilshhvtrntaiiavgggatgdfagfvaatllrgvhfiqvptti
    lahdssvggkvginskqgknligafyrptaviydldflktlpfkqilsgyaevykhalln
    gesatqdieqhfkdreilqslngmdkyiakgietkldivvadekeqgvrkflnlghtfgh
    aveyyhkiphghavmvgiiyqfivanalfdskhdishyiqyliqlgypldgvqmvlmrqf
    gdivvqhvdqltlqhaceqlkty
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1xahB (B:)
    mklqttypsnnypiyvehgaikyigtylnqfdqsfllideyvnqyfankfddilsyenvh
    kviipagektktfeqyqetleyilshhvtrntaiiavgggatgdfagfvaatllrgvhfi
    qvpttilahdssvggkvginskqgknligafyrptaviydldflktlpfkqilsgyaevy
    khallngesatqdieqhfkdreilqslngmdkyiakgietkldivvadekeqgvrkflnl
    ghtfghaveyyhkiphghavmvgiiyqfivanalfdskhdishyiqyliqlgypldmitd
    ldfetlyqymlsdkkndkqgvqmvlmrqfgdivvqhvdqltlqhaceqlktyfk
    

    Sequence, based on observed residues (ATOM records):
    >1xahB (B:)
    mklqttypsnnypiyvehgaikyigtylnqfdqsfllideyvnqyfankfdnvhkviipa
    gektktfeqyqetleyilshhvtrntaiiavgggatgdfagfvaatllrgvhfiqvptti
    lahdssvggkvginskqgknligafyrptaviydldflktlpfkqilsgyaevykhalln
    gesatqdieqhfkdreilqslngmdkyiakgietkldivvadekeqgvrkflnlghtfgh
    aveyyhkiphghavmvgiiyqfivanalfdskhdishyiqyliqlgypldtlyqymlgvq
    mvlmrqfgdivvqhvdqltlqhaceqlkty