PDB entry 1xaf

View 1xaf on RCSB PDB site
Description: Crystal Structure of Protein of Unknown Function YfiH from Shigella flexneri 2a str. 2457T
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, MCSG, Hypothetical protein, YfiH, Shigella flexneri 2a str. 2457T, PSI, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-08-25, released 2004-08-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.186
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orf, conserved hypothetical protein
    Species: Shigella flexneri [TaxId:198215]
    Gene: YfiH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K13 (Start-245)
      • modified residue (105)
      • modified residue (175)
      • modified residue (238)
    Domains in SCOPe 2.07: d1xafa_
  • Chain 'B':
    Compound: orf, conserved hypothetical protein
    Species: Shigella flexneri [TaxId:198215]
    Gene: YfiH
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q83K13 (Start-245)
      • modified residue (105)
      • modified residue (175)
      • modified residue (238)
    Domains in SCOPe 2.07: d1xafb_
  • Heterogens: ZN, ACT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xafA (A:)
    snamsklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaa
    gnlpskpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnrag
    tevaavhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavda
    kasaafiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrma
    sfiwli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xafA (A:)
    sklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlp
    skpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragteva
    avhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakasa
    afiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfiw
    li
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xafB (B:)
    snamsklivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaa
    gnlpskpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnrag
    tevaavhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavda
    kasaafiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrma
    sfiwli
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xafB (B:)
    klivpqwplpkgvaacsstriggvslppydslnlgahcgdnpdhveenrkrlfaagnlps
    kpvwleqvhgkdvlkltgepyaskradasysntpgtvcavmtadclpvlfcnragtevaa
    vhagwrglcagvleetvscfadkpenilawlgpaigprafevgaevreafmavdakasaa
    fiqhgdkyladiyqlarqrlanvgveqifggdrctytenetffsyrrdkttgrmasfiwl
    i