PDB entry 1xae

View 1xae on RCSB PDB site
Description: Crystal structure of wild type yellow fluorescent protein zFP538 from Zoanthus
Class: luminescent protein
Keywords: fluorescent protein, beta-can, beta-barrel, LUMINESCENT PROTEIN
Deposited on 2004-08-25, released 2005-02-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-06-30, with a file datestamp of 2009-06-26.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.206
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fluorescent protein fp538
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y4
      • chromophore (65)
    Domains in SCOPe 2.06: d1xaea_
  • Chain 'B':
    Compound: fluorescent protein fp538
    Species: Zoanthus sp. [TaxId:105402]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9U6Y4
      • chromophore (65)
    Domains in SCOPe 2.06: d1xaeb_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xaeA (A:)
    mahskhglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedi
    lsagfkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenci
    yhksifngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcq
    fdtvykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xaeA (A:)
    hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
    kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
    fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
    kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xaeB (B:)
    mahskhglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedi
    lsagfkygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenci
    yhksifngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcq
    fdtvykaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsala
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xaeB (B:)
    hglkeemtmkyhmegcvnghkfvitgegigypfkgkqtinlcvieggplpfsedilsagf
    kygdrifteypqdivdyfknscpagytwgrsflfedgavcicnvditvsvkenciyhksi
    fngmnfpadgpvmkkmttnweascekimpvpkqgilkgdvsmylllkdggryrcqfdtvy
    kaksvpskmpewhfiqhkllredrsdaknqkwqltehaiafpsa