PDB entry 1xad

View 1xad on RCSB PDB site
Description: chimera isopropylmalate dehydrogenase between bacillus subtilis (m) and thermus thermophilus (t) from n-terminal: 20% t middle 20% m residual 60% t, mutated at s82r. low temperature (150k) structure.
Class: oxidoreductase
Keywords: oxidoreductase, chimera
Deposited on 1995-11-09, released 1996-04-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.194
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-isopropylmalate dehydrogenase 2t2m6t s82r
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00351 (0-344)
      • conflict (78-79)
      • conflict (82-84)
      • conflict (87)
      • conflict (92)
      • conflict (95-96)
      • conflict (105)
      • conflict (109-110)
      • conflict (112-114)
      • conflict (119)
      • conflict (121-124)
      • conflict (127-128)
    Domains in SCOPe 2.08: d1xada_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xadA (A:)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdqnprelrpekgllsirkqldlfanlrpvkvfeslsdasplkk
    eyidnvdfvivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvlrhla