PDB entry 1xab

View 1xab on RCSB PDB site
Description: 3-isopropylmalate dehydrogenase, low temperature (150k) structure
Deposited on 1995-11-09, released 1996-04-03
The last revision prior to the SCOP 1.55 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.158
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1xab__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xab_ (-)
    mkvavlpgdgigpevteaalkvlraldeaeglglayevfpfggaaidafgepfpeptrkg
    veeaeavllgsvggpkwdglprkirpetgllslrksqdlfanlrpakvfpglerlsplke
    eiargvdvlivreltggiyfgeprgmseaeawnteryskpevervarvafeaarkrrkhv
    vsvdkanvlevgefwrktveevgrgypdvalehqyvdamamhlvrsparfdvvvtgnifg
    dilsdlasvlpgslgllpsaslgrgtpvfepvhgsapdiagkgianptaailsaammleh
    afglvelarkvedavakalletpppdlggsagteaftatvlrhla