PDB entry 1xa8

View 1xa8 on RCSB PDB site
Description: Crystal Structure Analysis of Glutathione-dependent formaldehyde-activating enzyme (Gfa)
Class: lyase
Keywords: formaldehyde, glutathione, S-S bond, LYASE
Deposited on 2004-08-25, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1xa8a1, d1xa8a2
  • Chain 'B':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (0-2)
    Domains in SCOPe 2.07: d1xa8b1, d1xa8b2
  • Chain 'C':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1xa8c1, d1xa8c2
  • Chain 'D':
    Compound: Glutathione-dependent formaldehyde-activating enzyme
    Species: Paracoccus denitrificans [TaxId:266]
    Gene: gfa
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q51669 (3-195)
      • cloning artifact (2)
    Domains in SCOPe 2.07: d1xa8d1, d1xa8d2
  • Heterogens: ZN, SO4, GSH, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xa8A (A:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1xa8B (B:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1xa8C (C:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa8C (C:)
    mvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkp
    egaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygl
    dfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmda
    iathiakrsgalaa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1xa8D (D:)
    ghmvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcw
    kpegaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfy
    gldfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplm
    daiathiakrsgalaa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa8D (D:)
    mvdtsgvkihpavdngikpaqpgfaggtlhckcstnpvrvavraqtahnhvcgctkcwkp
    egaifsqvavvgrdalevlegaekleivnaeapiqrhrcrdcgvhmygrienrdhpfygl
    dfvhtelsdedgwsapefaafvssiiesgvdpsrmeairarlrelglepydalspplmda
    iathiakrsgalaa