PDB entry 1xa7

View 1xa7 on RCSB PDB site
Description: Crystal structure of the benzylpenicillin-acylated BlaR1 sensor domain from Staphylococcus aureus
Class: signaling protein
Keywords: beta-lactamase, benzylpenicillin, penicillin G, BlaR1, sensor domain, antibiotic resistance, beta-lactam, SIGNALING PROTEIN
Deposited on 2004-08-25, released 2004-09-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.222
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: regulatory protein blar1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: blaR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18357
      • modified residue (34)
      • modified residue (37)
      • modified residue (58)
      • modified residue (66)
      • modified residue (81)
      • modified residue (103)
      • modified residue (145)
      • modified residue (163-164)
      • modified residue (248)
    Domains in SCOPe 2.07: d1xa7a_
  • Chain 'B':
    Compound: regulatory protein blar1
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: blaR1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18357
      • modified residue (34)
      • modified residue (37)
      • modified residue (58)
      • modified residue (66)
      • modified residue (81)
      • modified residue (103)
      • modified residue (145)
      • modified residue (163-164)
      • modified residue (248)
    Domains in SCOPe 2.07: d1xa7b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xa7A (A:)
    gqsitdynykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnst
    ykiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqip
    knytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqls
    ssllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknael
    isekilkemgvlngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa7A (A:)
    itdynykkplqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnstykiylam
    fgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytatq
    lkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlsssllikk
    nekyelygktgtgigkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekilkem
    gv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xa7B (B:)
    gqsitdynykkplhndyqildkskifgsnsgsfvmysmkkdkyyiynekesrkryspnst
    ykiylamfgldrhiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqip
    knytatqlkqlnygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqls
    ssllikknekyelygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknael
    isekilkemgvlngq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa7B (B:)
    nykkplhndyqildkskifgsfvmysmkdkyyiynekesrkryspnstykiylamfgldr
    hiindensrmswnhkhypfdawnkeqdlntamqnsvnwyferisdqipknytatqlkqln
    ygnknlgsyksywmedslkisnleqvivfknmmeqnnhfskkaknqlsssllikknekye
    lygktgtgivngkynngwfvgyvitnhdkyyfathlsdgkpsgknaelisekilkemgvl