PDB entry 1xa6

View 1xa6 on RCSB PDB site
Description: Crystal Structure of the Human Beta2-Chimaerin
Deposited on 2004-08-25, released 2004-11-23
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-23, with a file datestamp of 2004-11-23.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.252
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xa6A (A:)
    mrllsslsgssvssdaeeyqppiwksylyqlqqeaprpkriicprevenrpkyygrefhg
    iisreqadellggvegayilresqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfes
    ihdlvtdglitlyietkaaeyiskmttnpiyehigyatllrekvsrrlsrskneprktnv
    theehtavekisslvrraalthndnhfnyekthnfkvhtfrgphwceycanfmwgliaqg
    vrcsdcglnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireie
    arglkseglyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpip
    vitydtyskfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfm
    naenlgivfgptlmrppedstlttlhdmryqklivqilienedvlf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa6A (A:)
    ppiwksylyqlqqeaprpkriicprevenrpkyygrefhgiisreqadellggvegayil
    resqrqpgcytlalrfgnqtlnyrlfhdgkhfvgekrfesihdlvtdglitlyietkaae
    yiskmttnpiyehigyatllryekthnfkvhtfrgphwceycanfmwgliaqgvrcsdcg
    lnvhkqcskhvpndcqpdlkrikkvyccdlttlvkahntqrpmvvdicireiearglkse
    glyrvsgftehiedvkmafdrdgekadisanvypdiniitgalklyfrdlpipvitydty
    skfidaakisnaderleavhevlmllppahyetlrylmihlkkvtmnekdnfmnaenlgi
    vfgptlmrppedstlttlhdmryqklivqilienedvlf