PDB entry 1xa4

View 1xa4 on RCSB PDB site
Description: crystal structure of caib, a type iii coa transferase in carnitine metabolism
Deposited on 2004-08-25, released 2004-11-16
The last revision prior to the SCOP 1.71 freeze date was dated 2004-11-16, with a file datestamp of 2004-11-16.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.145
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1xa4a_
  • Chain 'B':
    Domains in SCOP 1.71: d1xa4b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xa4A (A:)
    mhhhhhhgstslykkagsetlyiqgdhlpmpkfgplaglrvvfsgieiagpfagqmfaew
    gaeviwienvawadtirvqpnypqlsrrnlhalslnifkdegreaflklmettdifieas
    kgpafarrgitdevlwqhnpklviahlsgfgqygteeytnlpayntiaqafsgyliqngd
    vdqpmpafpytadyfsgltattaalaalhkvretgkgesidiamyevmlrmgqyfmmdyf
    nggemcprmskgkdpyyagcglykcadgyivmelvgitqieecfkdiglahllgtpeipe
    gtqlihriecpygplveekldawlathtiaevkerfaelniacakvltvpelesnpqyva
    resitqwqtmdgrtckgpnimpkfknnpgqiwrgmpshgmdtaailknigysendiqelv
    skglakvedsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa4A (A:)
    lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
    rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
    sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
    lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
    gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
    tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
    pgqiwrgmpshgmdtaailknigysendiqelvskglakv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xa4B (B:)
    mhhhhhhgstslykkagsetlyiqgdhlpmpkfgplaglrvvfsgieiagpfagqmfaew
    gaeviwienvawadtirvqpnypqlsrrnlhalslnifkdegreaflklmettdifieas
    kgpafarrgitdevlwqhnpklviahlsgfgqygteeytnlpayntiaqafsgyliqngd
    vdqpmpafpytadyfsgltattaalaalhkvretgkgesidiamyevmlrmgqyfmmdyf
    nggemcprmskgkdpyyagcglykcadgyivmelvgitqieecfkdiglahllgtpeipe
    gtqlihriecpygplveekldawlathtiaevkerfaelniacakvltvpelesnpqyva
    resitqwqtmdgrtckgpnimpkfknnpgqiwrgmpshgmdtaailknigysendiqelv
    skglakvedsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa4B (B:)
    lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
    rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
    sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
    lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
    gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
    tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
    pgqiwrgmpshgmdtaailknigysendiqelvskglakv