PDB entry 1xa4

View 1xa4 on RCSB PDB site
Description: Crystal structure of CaiB, a type III CoA transferase in carnitine metabolism
Class: transferase
Keywords: CaiB, carnitine, CoA transferase, CoA, Coenzyme A, interlocked, dimer, Bis-tris
Deposited on 2004-08-25, released 2004-11-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.145
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Crotonobetainyl-CoA:carnitine CoA-transferase
    Species: Escherichia coli [TaxId:562]
    Gene: CaiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31572
      • modified residue (29)
      • modified residue (55)
      • modified residue (109)
      • modified residue (184)
      • modified residue (223)
      • modified residue (227)
      • modified residue (230)
      • modified residue (235-236)
      • modified residue (244)
      • modified residue (248)
      • modified residue (271)
      • modified residue (369)
      • modified residue (380)
      • modified residue (394)
      • modified residue (399)
    Domains in SCOPe 2.07: d1xa4a_
  • Chain 'B':
    Compound: Crotonobetainyl-CoA:carnitine CoA-transferase
    Species: Escherichia coli [TaxId:562]
    Gene: CaiB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31572
      • modified residue (29)
      • modified residue (55)
      • modified residue (109)
      • modified residue (184)
      • modified residue (223)
      • modified residue (227)
      • modified residue (230)
      • modified residue (235-236)
      • modified residue (244)
      • modified residue (248)
      • modified residue (271)
      • modified residue (369)
      • modified residue (380)
      • modified residue (394)
      • modified residue (399)
    Domains in SCOPe 2.07: d1xa4b_
  • Heterogens: SO4, COA, BTB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xa4A (A:)
    mhhhhhhgstslykkagsetlyiqgdhlpmpkfgplaglrvvfsgieiagpfagqmfaew
    gaeviwienvawadtirvqpnypqlsrrnlhalslnifkdegreaflklmettdifieas
    kgpafarrgitdevlwqhnpklviahlsgfgqygteeytnlpayntiaqafsgyliqngd
    vdqpmpafpytadyfsgltattaalaalhkvretgkgesidiamyevmlrmgqyfmmdyf
    nggemcprmskgkdpyyagcglykcadgyivmelvgitqieecfkdiglahllgtpeipe
    gtqlihriecpygplveekldawlathtiaevkerfaelniacakvltvpelesnpqyva
    resitqwqtmdgrtckgpnimpkfknnpgqiwrgmpshgmdtaailknigysendiqelv
    skglakvedsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa4A (A:)
    lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
    rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
    sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
    lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
    gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
    tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
    pgqiwrgmpshgmdtaailknigysendiqelvskglakv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xa4B (B:)
    mhhhhhhgstslykkagsetlyiqgdhlpmpkfgplaglrvvfsgieiagpfagqmfaew
    gaeviwienvawadtirvqpnypqlsrrnlhalslnifkdegreaflklmettdifieas
    kgpafarrgitdevlwqhnpklviahlsgfgqygteeytnlpayntiaqafsgyliqngd
    vdqpmpafpytadyfsgltattaalaalhkvretgkgesidiamyevmlrmgqyfmmdyf
    nggemcprmskgkdpyyagcglykcadgyivmelvgitqieecfkdiglahllgtpeipe
    gtqlihriecpygplveekldawlathtiaevkerfaelniacakvltvpelesnpqyva
    resitqwqtmdgrtckgpnimpkfknnpgqiwrgmpshgmdtaailknigysendiqelv
    skglakvedsthhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa4B (B:)
    lpmpkfgplaglrvvfsgieiagpfagqmfaewgaeviwienvawadtirvqpnypqlsr
    rnlhalslnifkdegreaflklmettdifieaskgpafarrgitdevlwqhnpklviahl
    sgfgqygteeytnlpayntiaqafsgyliqngdvdqpmpafpytadyfsgltattaalaa
    lhkvretgkgesidiamyevmlrmgqyfmmdyfnggemcprmskgkdpyyagcglykcad
    gyivmelvgitqieecfkdiglahllgtpeipegtqlihriecpygplveekldawlath
    tiaevkerfaelniacakvltvpelesnpqyvaresitqwqtmdgrtckgpnimpkfknn
    pgqiwrgmpshgmdtaailknigysendiqelvskglakv