PDB entry 1xa0

View 1xa0 on RCSB PDB site
Description: crystal structure of mcsg target apc35536 from bacillus stearothermophilus
Deposited on 2004-08-24, released 2004-10-05
The last revision prior to the SCOP 1.71 freeze date was dated 2004-10-05, with a file datestamp of 2004-10-05.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.218
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1xa0A (A:)
    msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
    pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkglt
    lkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveas
    tgkaaehdylrvlgakevlaredvmaerirpldkqrwaaavdpvggrtlatvlsrmrygg
    avavsgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaq
    eislaelpqalkrilrgelrgrtvvrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa0A (A:)
    msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
    pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkglt
    lkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveas
    tgkaaehdylrvlgakevlareldkqrwaaavdpvggrtlatvlsrmryggavavsgltg
    gaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaqeislaelpq
    alkrilrgelrgrtvvrla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1xa0B (B:)
    msafqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivkty
    pfvpgidlagvvvssqhprfregdeviatgyeigvthfggyseyarlhgewlvplpkglt
    lkeamaigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveas
    tgkaaehdylrvlgakevlaredvmaerirpldkqrwaaavdpvggrtlatvlsrmrygg
    avavsgltggaevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaq
    eislaelpqalkrilrgelrgrtvvrla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1xa0B (B:)
    safqafvvnkteteftagvqtismddlpegdvlvrvhyssvnykdglasipdgkivktyp
    fvpgidlagvvvssqhpegdeviatgyeigvthfggyseyarlhgewlvplpkgltlkea
    maigtagftaalsihrleehgltpergpvlvtgatggvgslavsmlakrgytveastgka
    aehdylrvlgakevlaerirpldkqrwaaavdpvggrtlatvlsrmryggavavsgltgg
    aevpttvhpfilrgvsllgidsvycpmdlrlriwerlagdlkpdleriaqeislaelpqa
    lkrilrgelrgrtvvrl