PDB entry 1x9z

View 1x9z on RCSB PDB site
Description: Crystal structure of the MutL C-terminal domain
Class: replication, signaling protein
Keywords: alpha-beta fold, dimer, REPLICATION, SIGNALING PROTEIN
Deposited on 2004-08-24, released 2004-10-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.236
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA mismatch repair protein mutL
    Species: Escherichia coli [TaxId:562]
    Gene: MUTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23367
      • modified residue (138)
      • modified residue (146)
    Domains in SCOPe 2.07: d1x9za_
  • Chain 'B':
    Compound: DNA mismatch repair protein mutL
    Species: Escherichia coli [TaxId:562]
    Gene: MUTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23367 (4-End)
      • modified residue (138)
      • modified residue (146)
    Domains in SCOPe 2.07: d1x9zb_
  • Heterogens: CL, NA, GOL, IPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9zA (A:)
    gshmsqsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqpllip
    lrlkvsaeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligyla
    kqsvfepgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhp
    aikalkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9zA (A:)
    qsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqplliplrlkv
    saeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligylakqsvf
    epgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhpaikal
    kd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9zB (B:)
    gshmsqsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqpllip
    lrlkvsaeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligyla
    kqsvfepgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhp
    aikalkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9zB (B:)
    sqsfgrvltivhsdcallerdgnisllslpvaerwlrqaqltpgeapvcaqplliplrlk
    vsaeeksalekaqsalaelgidfqsdaqhvtiravplplrqqnlqilipeligylakqsv
    fepgniaqwiarnlmsehaqwsmaqaitlladverlcpqlvktppggllqsvdlhpaika
    lk