PDB entry 1x9y

View 1x9y on RCSB PDB site
Description: The prostaphopain B structure
Class: hydrolase
Keywords: half-barrel, barrel-sandwich-hybrid, HYDROLASE
Deposited on 2004-08-24, released 2004-11-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.244
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteine proteinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70UQ8 (Start-358)
      • cloning artifact (359-362)
    Domains in SCOPe 2.07: d1x9ya1, d1x9ya2, d1x9ya3
  • Chain 'B':
    Compound: cysteine proteinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70UQ8 (Start-358)
      • cloning artifact (359-362)
    Domains in SCOPe 2.07: d1x9yb1, d1x9yb2, d1x9yb3
  • Chain 'C':
    Compound: cysteine proteinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70UQ8 (Start-358)
      • cloning artifact (359-362)
    Domains in SCOPe 2.07: d1x9yc1, d1x9yc2, d1x9yc3
  • Chain 'D':
    Compound: cysteine proteinase
    Species: Staphylococcus aureus [TaxId:1280]
    Gene: SSPB
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q70UQ8 (Start-358)
      • cloning artifact (359-362)
    Domains in SCOPe 2.07: d1x9yd1, d1x9yd2, d1x9yd3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9yA (A:)
    gsdshskqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfn
    geednsyyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdkns
    nitvltdekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkveen
    eaiqedqvqyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypev
    seqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpn
    dphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigyl
    evpihrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9yA (A:)
    kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
    yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
    dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkvqyentlknf
    kireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpncatfpnqmie
    ygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghalavvgnakin
    dqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigylevp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9yB (B:)
    gsdshskqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfn
    geednsyyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdkns
    nitvltdekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkveen
    eaiqedqvqyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypev
    seqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpn
    dphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigyl
    evpihrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9yB (B:)
    kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
    yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
    dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkvqyentlknf
    kireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpncatfpnqmie
    ygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghalavvgnakin
    dqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigylevp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1x9yC (C:)
    gsdshskqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfn
    geednsyyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdkns
    nitvltdekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkveen
    eaiqedqvqyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypev
    seqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpn
    dphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigyl
    evpihrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9yC (C:)
    kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
    yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
    dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkvqyentlknf
    kireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpncatfpnqmie
    ygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghalavvgnakin
    dqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigylevp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1x9yD (D:)
    gsdshskqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfn
    geednsyyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdkns
    nitvltdekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkveen
    eaiqedqvqyentlknfkireqqfdnswcagfsmaallnatkntdtynahdimrtlypev
    seqdlpncatfpnqmieygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpn
    dphlghalavvgnakindqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigyl
    evpihrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9yD (D:)
    kqleinvksdkvpqkvkdlaqqqfagyakaldkqsnaktgkyelgeafkiykfngeedns
    yyypvikdgkivytltlspknkddlnkskedmnysvkisnfiakdldqikdknsnitvlt
    dekgfyfeedgkvrlvkatplannikekesaktvspqlkqelkttvtptkvqyentlknf
    kireqqfdnswcagfsmaallnatkntdtynahdimrtlypevseqdlpncatfpnqmie
    ygksqgrdihyqegvpsynqvdqltkdnvgimilaqsvsqnpndphlghalavvgnakin
    dqekliywnpwdtelsiqdadssllhlsfnrdynwygsmigylevp