PDB entry 1x9t

View 1x9t on RCSB PDB site
Description: The crystal structure of human adenovirus 2 penton base in complex with an ad2 N-terminal fibre peptide
Deposited on 2004-08-24, released 2005-01-18
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.5 Å
R-factor: 0.306
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: penton protein
    Species: Human adenovirus C [TaxId:10515]
    Gene: penton base
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: N-terminl peptide of Fiber protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1X9T
  • Heterogens: C15

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1x9tA (A:)
    tggrnsiryselaplfdttrvylvdnkstdvaslnyqndhsnflttviqnndyspgeast
    qtinlddrshwggdlktilhtnmpnvnefmftnkfkarvmvsrsltkdkqvelkyewvef
    tlpegnysetmtidlmnnaivehylkvgrqngvlesdigvkfdtrnfrlgfdpvtglvmp
    gvytneafhpdiillpgcgvdfthsrlsnllgirkrqpfqegfrityddleggnipalld
    vdayqaslkddteqggdgagggnnsgsgaeensnaaaaamqpvedmndhairgdtfatra
    eekraeaeaaaeaaapaaqpevekpqkkpvikpltedskkrsynlisndstftqyrswyl
    aynygdpqtgirswtllctpdvtcgseqvywslpdmmqdpvtfrstsqisnfpvvgaell
    pvhsksfyndqavysqlirqftslthvfnrfpenqilarppaptittvsenvpaltdhgt
    lplrnsiggvqrvtitdarrrtcpyvykalgivsprvlssrtf
    

    Sequence, based on observed residues (ATOM records):
    >1x9tA (A:)
    rnsiryselaplfdttrvylvdnkstdvaslnyqndhsnflttviqnndyspgeastqti
    nlddrshwggdlktilhtnmpnvnefmftnkfkarvmvsrsltkdkqvelkyewveftlp
    egnysetmtidlmnnaivehylkvgrqngvlesdigvkfdtrnfrlgfdpvtglvmpgvy
    tneafhpdiillpgcgvdfthsrlsnllgirkrqpfqegfrityddleggnipalldvda
    yqaslkkpvikpltedskkrsynlisndstftqyrswylaynygdpqtgirswtllctpd
    vtcgseqvywslpdmmqdpvtfrstsqisnfpvvgaellpvhsksfyndqavysqlirqf
    tslthvfnrfpenqilarppaptittvsenvpaltdhgtlplrnsiggvqrvtitdarrr
    tcpyvykalgivsprvlssr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1x9tB (B:)
    mkrarpsedtfnpvypydtec
    

    Sequence, based on observed residues (ATOM records):
    >1x9tB (B:)
    tfnpvypydt