PDB entry 1x9r

View 1x9r on RCSB PDB site
Description: Umecyanin from Horse Raddish- Crystal Structure of the oxidised form
Class: electron transport
Keywords: Umecyanin, Cupredoxin, Phytocyanin, copper binding site, beta barrel, ELECTRON TRANSPORT
Deposited on 2004-08-24, released 2005-03-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.223
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Umecyanin
    Species: Armoracia rusticana [TaxId:3704]
    Gene: UMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42849 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1x9ra_
  • Chain 'B':
    Compound: Umecyanin
    Species: Armoracia rusticana [TaxId:3704]
    Gene: UMC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P42849 (1-End)
      • initiating methionine (0)
    Domains in SCOPe 2.07: d1x9rb_
  • Heterogens: CU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9rA (A:)
    medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk
    enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvgaggagggatpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9rA (A:)
    medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk
    enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvga
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1x9rB (B:)
    medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk
    enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvgaggagggatpga
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9rB (B:)
    medydvggdmewkrpsdpkfyitwatgktfrvgdelefdfaagmhdvavvtkdafdnckk
    enpishmttppvkimlnttgpqyyictvgdhcrvgqklsinvvg