PDB entry 1x9q

View 1x9q on RCSB PDB site
Description: 4m5.3 anti-fluorescein single chain antibody fragment (scFv)
Class: immune system
Keywords: very high affinity, antibody binding, electrostatics, directed evolution, single chain antibody, IMMUNE SYSTEM
Deposited on 2004-08-24, released 2005-03-22
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.193
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4m5.3 anti-fluorescein single chain antibody fragment
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1X9Q (Start-267)
    Domains in SCOPe 2.04: d1x9qa1, d1x9qa2
  • Heterogens: ACT, FLU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9qA (A:)
    aarpdykddddkasdvvmtqtplslpvslgdqasiscrssqslvhsngntylrwylqkpg
    qspkvliykvsnrvsgvpdrfsgsgsgtdftlkinrveaedlgvyfcsqsthvpwtfggg
    tkleikssaddakkdaakkddakkddakkdggvkldetggglvqpggamklscvtsgftf
    ghywmnwvrqspekglewvaqfrnkpynyetyysdsvkgrftisrddskssvylqmnnlr
    vedtgiyyctgasygmeylgqgtsvtvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9qA (A:)
    sdvvmtqtplslpvslgdqasiscrssqslvhsngntylrwylqkpgqspkvliykvsnr
    vsgvpdrfsgsgsgtdftlkinrveaedlgvyfcsqsthvpwtfgggtklekdggvklde
    tggglvqpggamklscvtsgftfghywmnwvrqspekglewvaqfrnkpynyetyysdsv
    kgrftisrddskssvylqmnnlrvedtgiyyctgasygmeylgqgtsvtvs