PDB entry 1x9n

View 1x9n on RCSB PDB site
Description: Crystal Structure of Human DNA Ligase I bound to 5'-adenylated, nicked DNA
Class: Ligase/DNA
Keywords: DNA ligase, 5'-adenylated nicked DNA, protein-DNA complex, Ligase-DNA COMPLEX
Deposited on 2004-08-23, released 2004-11-30
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.236
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA ligase I
    Species: Homo sapiens [TaxId:9606]
    Gene: LIG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P18858
      • modified residue (76)
      • modified residue (161)
      • modified residue (248)
      • modified residue (269)
      • modified residue (311)
      • modified residue (491)
    Domains in SCOPe 2.04: d1x9na1, d1x9na2, d1x9na3
  • Chain 'B':
    Compound: dideoxy terminated DNA
  • Chain 'C':
    Compound: 5'-phosphorylated DNA
  • Chain 'D':
    Compound: Template DNA
  • Heterogens: AMP

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1x9nA (A:)
    mtprkpavkkevkeeepgapgkegaaegpldpsgynpaknnyhpvedacwkpgqkvpyla
    vartfekieevsarlrmvetlsnllrsvvalsppdllpvlylslnhlgppqqglelgvgd
    gvllkavaqatgrqlesvraeaaekgdvglvaensrstqrlmlppppltasgvfskfrdi
    arltgsastakkidiikglfvacrhsearfiarslsgrlrlglaeqsvlaalsqavsltp
    pgqefppamvdagkgktaearktwleeqgmilkqtfcevpdldriipvllehglerlpeh
    cklspgiplkpmlahptrgisevlkrfeeaaftceykydgqraqihaleggevkifsrnq
    edntgkypdiisripkiklpsvtsfildteavawdrekkqiqpfqvlttrkrkevdasei
    qvqvclyafdliylngeslvreplsrrrqllrenfvetegefvfatsldtkdieqiaefl
    eqsvkdsceglmvktldvdatyeiakrshnwlklkkdyldgvgdtldlvvigaylgrgkr
    agryggfllasydedseelqaicklgtgfsdeeleehhqslkalvlpsprpyvridgavi
    pdhwldpsavwevkcadlslspiypaarglvdsdkgislrfprfirvredkqpeqattsa
    qvaclyrkqsqiqnqqgedsgsdpedty
    

    Sequence, based on observed residues (ATOM records): (download)
    >1x9nA (A:)
    dpsgynpaknnyhpvedacwkpgqkvpylavartfekieevsarlrmvetlsnllrsvva
    lsppdllpvlylslnhlgppqqglelgvgdgvllkavaqatgrqlesvraeaaekgdvgl
    vaemlppppltasgvfskfrdiarltgsastakkidiikglfvacrhsearfiarslsgr
    lrlglaeqsvlaalsqavsltppgqefppamvdagkgktaearktwleeqgmilkqtfce
    vpdldriipvllehglerlpehcklspgiplkpmlahptrgisevlkrfeeaaftceyky
    dgqraqihaleggevkifsrnqedntgkypdiisripkiklpsvtsfildteavawdrek
    kqiqpfqvlttrkrkevdaseiqvqvclyafdliylngeslvreplsrrrqllrenfvet
    egefvfatsldtkdieqiaefleqsvkdsceglmvktldvdatyeiakrshnwlklkkdy
    ldgvgdtldlvvigaylgrgkragryggfllasydedseelqaicklgtgfsdeeleehh
    qslkalvlpsprpyvridgavipdhwldpsavwevkcadlslspiypaarglvdsdkgis
    lrfprfirvredkqpeqattsaqvaclyrkqs
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.